PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca52773.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 385aa    MW: 44084.4 Da    PI: 6.0884
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca52773.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1782.6e-5571361129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPtdeelv++yL++k+++++++l ++ikevd+yk+ePwdL +  k+   +++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++s k
  Dca52773.1   7 VPPGFRFHPTDEELVDYYLRRKINSRRIDL-DIIKEVDLYKIEPWDLLEicKLGDeDQSEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYS-K 103
                 69****************************.99**************743344442455**************************************.9 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                 +el+g++ktLv+ykgrap+g+k+dW+mheyrle
  Dca52773.1 104 HELIGMRKTLVYYKGRAPNGQKSDWIMHEYRLE 136
                 99*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.55E-615156IPR003441NAC domain
PROSITE profilePS5100559.0457156IPR003441NAC domain
PfamPF023657.8E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MNTCTHVPPG FRFHPTDEEL VDYYLRRKIN SRRIDLDIIK EVDLYKIEPW DLLEICKLGD  60
EDQSEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YSKHELIGMR KTLVYYKGRA  120
PNGQKSDWIM HEYRLETDEN GPPQEEGWVV CRAFKKKPTT MRRISEHDSP YWYDHDQSSL  180
MSDMDSPNQS YQSNNNNNNN ILNNPSYTRK IPILDHNLPF QVPQQHLINL PFLENTKISN  240
TYNNSNNNNS NNNNALVLHG IEAMNNNHQG SNSTQQIAFN NDNNNQNSTS MAALIGGNNF  300
NDHGAFDDQL TDWRVLDKFV ASQLSQDDVS KEINNNNNYT STIVSSSGLL LPCPLNDQVT  360
TTTKEASTPD NASTSTSSSQ IDAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-50715715169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010672023.11e-154PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-122NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A0J8CQ751e-153A0A0J8CQ75_BETVU; Uncharacterized protein
STRINGPOPTR_0012s14660.11e-146(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.14e-98NAC 007